TCP10L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2117470
| Artikelname: |
TCP10L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2117470 |
| Hersteller Artikelnummer: |
orb2117470 |
| Alternativnummer: |
BYT-ORB2117470-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human TCP10L |
| Konjugation: |
Biotin |
| Alternative Synonym: |
PRED77, C21orf77, TCP10A-1, TCP10A-2, LINC00846 |
| TCP10L Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
24kDa |
| NCBI: |
653260 |
| UniProt: |
Q8TDR4 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: ASPHAGQESHTLALEPAFGKISPLSADEETIPKYAGHKNQSATLLGQRSS |
