TCP10L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2117470
| Article Name: |
TCP10L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2117470 |
| Supplier Catalog Number: |
orb2117470 |
| Alternative Catalog Number: |
BYT-ORB2117470-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human TCP10L |
| Conjugation: |
Biotin |
| Alternative Names: |
PRED77, C21orf77, TCP10A-1, TCP10A-2, LINC00846 |
| TCP10L Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
24kDa |
| NCBI: |
653260 |
| UniProt: |
Q8TDR4 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: ASPHAGQESHTLALEPAFGKISPLSADEETIPKYAGHKNQSATLLGQRSS |
