Pnkd Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2118496
| Artikelname: |
Pnkd Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2118496 |
| Hersteller Artikelnummer: |
orb2118496 |
| Alternativnummer: |
BYT-ORB2118496-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Konjugation: |
Biotin |
| Alternative Synonym: |
Brp, MR-1, Brp17, Tahccp2, AI854243, MNCb-5687, 2210013N15Rik, 2810403H05Rik |
| Pnkd Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
15kDa |
| NCBI: |
079856 |
| UniProt: |
Q69ZP3 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: MAAVVAATALKGRGARNARVLRGILSGATANKASQNRTRALQSHSSPECK |