Pnkd Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2118496
| Article Name: |
Pnkd Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2118496 |
| Supplier Catalog Number: |
orb2118496 |
| Alternative Catalog Number: |
BYT-ORB2118496-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Conjugation: |
Biotin |
| Alternative Names: |
Brp, MR-1, Brp17, Tahccp2, AI854243, MNCb-5687, 2210013N15Rik, 2810403H05Rik |
| Pnkd Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
15kDa |
| NCBI: |
079856 |
| UniProt: |
Q69ZP3 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: MAAVVAATALKGRGARNARVLRGILSGATANKASQNRTRALQSHSSPECK |
