TMCC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2118847
Artikelname: TMCC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2118847
Hersteller Artikelnummer: orb2118847
Alternativnummer: BYT-ORB2118847-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMCC1
Konjugation: Biotin
Alternative Synonym: DKFZp686M0169, FLJ42680
TMCC1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 36kDa
NCBI: 055823
UniProt: Q6N039
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK