TMCC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2118847
Article Name: TMCC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2118847
Supplier Catalog Number: orb2118847
Alternative Catalog Number: BYT-ORB2118847-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMCC1
Conjugation: Biotin
Alternative Names: DKFZp686M0169, FLJ42680
TMCC1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 055823
UniProt: Q6N039
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YQSYERARDIQEALEACQTRISKMELQQQQQQVVQLEGLENATARNLLGK