EDA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119093
Artikelname: EDA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119093
Hersteller Artikelnummer: orb2119093
Alternativnummer: BYT-ORB2119093-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EDA
Konjugation: Biotin
Alternative Synonym: ED1, HED, EDA1, EDA2, HED1, ODT1, XHED, ECTD1, XLHED, ED1-A1, ED1-A2, EDA-A1, EDA-A2, TNLG7C, STHAGX1
EDA Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 001005609
UniProt: B7ZLU4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: HLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTY