EDA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119093
Article Name: EDA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119093
Supplier Catalog Number: orb2119093
Alternative Catalog Number: BYT-ORB2119093-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EDA
Conjugation: Biotin
Alternative Names: ED1, HED, EDA1, EDA2, HED1, ODT1, XHED, ECTD1, XLHED, ED1-A1, ED1-A2, EDA-A1, EDA-A2, TNLG7C, STHAGX1
EDA Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 001005609
UniProt: B7ZLU4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTY