OR2AT4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119135
Artikelname: OR2AT4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119135
Hersteller Artikelnummer: orb2119135
Alternativnummer: BYT-ORB2119135-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OR2AT4
Konjugation: Biotin
Alternative Synonym: OR11-265
OR2AT4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 001005285
UniProt: A6NND4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI