OR2AT4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2119135
| Article Name: |
OR2AT4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2119135 |
| Supplier Catalog Number: |
orb2119135 |
| Alternative Catalog Number: |
BYT-ORB2119135-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human OR2AT4 |
| Conjugation: |
Biotin |
| Alternative Names: |
OR11-265 |
| OR2AT4 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
35kDa |
| NCBI: |
001005285 |
| UniProt: |
A6NND4 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI |
