HMGCR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119354
Artikelname: HMGCR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119354
Hersteller Artikelnummer: orb2119354
Alternativnummer: BYT-ORB2119354-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human HMGCR
Konjugation: Biotin
Alternative Synonym: LDLCQ3
HMGCR Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 97kDa
UniProt: P04035
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVM