HMGCR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119354
Article Name: HMGCR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119354
Supplier Catalog Number: orb2119354
Alternative Catalog Number: BYT-ORB2119354-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human HMGCR
Conjugation: Biotin
Alternative Names: LDLCQ3
HMGCR Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 97kDa
UniProt: P04035
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVM