Slc35f3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2119656
Artikelname: Slc35f3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2119656
Hersteller Artikelnummer: orb2119656
Alternativnummer: BYT-ORB2119656-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation: FITC
Alternative Synonym: B230375D17Rik
Slc35f3 Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 780643
UniProt: Q1LZI2
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: IGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEETAESSGDLGTGPQSRSRR