Slc35f3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2119656
Article Name: Slc35f3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119656
Supplier Catalog Number: orb2119656
Alternative Catalog Number: BYT-ORB2119656-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: FITC
Alternative Names: B230375D17Rik
Slc35f3 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 780643
UniProt: Q1LZI2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEETAESSGDLGTGPQSRSRR