SLC22A12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119717
Artikelname: SLC22A12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119717
Hersteller Artikelnummer: orb2119717
Alternativnummer: BYT-ORB2119717-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A12
Konjugation: Biotin
Alternative Synonym: RST, OAT4L, URAT1
SLC22A12 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 653186
UniProt: Q96S37
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALLAISIPPGPNQR