SLC22A12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119717
Article Name: SLC22A12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119717
Supplier Catalog Number: orb2119717
Alternative Catalog Number: BYT-ORB2119717-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLC22A12
Conjugation: Biotin
Alternative Names: RST, OAT4L, URAT1
SLC22A12 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 653186
UniProt: Q96S37
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPEALLAISIPPGPNQR