SLC39A11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2119720
| Artikelname: |
SLC39A11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2119720 |
| Hersteller Artikelnummer: |
orb2119720 |
| Alternativnummer: |
BYT-ORB2119720-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human SLC39A11 |
| Konjugation: |
Biotin |
| Alternative Synonym: |
ZIP11, ZIP-11, C17orf26 |
| SLC39A11 Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
35kDa |
| NCBI: |
631916 |
| UniProt: |
B2R8H7 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: GGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASATFESARNLAIG |
