SLC39A11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119720
Article Name: SLC39A11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119720
Supplier Catalog Number: orb2119720
Alternative Catalog Number: BYT-ORB2119720-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLC39A11
Conjugation: Biotin
Alternative Names: ZIP11, ZIP-11, C17orf26
SLC39A11 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 631916
UniProt: B2R8H7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASATFESARNLAIG