SLCO5A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2119786
Artikelname: SLCO5A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2119786
Hersteller Artikelnummer: orb2119786
Alternativnummer: BYT-ORB2119786-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLCO5A1
Konjugation: Biotin
Alternative Synonym: OATPJ, OATP-J, OATP5A1, OATPRP4, OATP-RP4, SLC21A15
SLCO5A1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 92kDa
NCBI: 112220
UniProt: Q9H2Y9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NMTFLFVSLSYTAESAIVTAFITFIPKFIESQFGIPASNASIYTGVIIVP