SLCO5A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119786
Article Name: SLCO5A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119786
Supplier Catalog Number: orb2119786
Alternative Catalog Number: BYT-ORB2119786-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SLCO5A1
Conjugation: Biotin
Alternative Names: OATPJ, OATP-J, OATP5A1, OATPRP4, OATP-RP4, SLC21A15
SLCO5A1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 92kDa
NCBI: 112220
UniProt: Q9H2Y9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NMTFLFVSLSYTAESAIVTAFITFIPKFIESQFGIPASNASIYTGVIIVP