ABCC8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2120437
Artikelname: ABCC8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2120437
Hersteller Artikelnummer: orb2120437
Alternativnummer: BYT-ORB2120437-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ABCC8
Konjugation: Biotin
Alternative Synonym: HI, SUR, HHF1, MRP8, PHHI, SUR1, ABC36, HRINS, PNDM3, TNDM2, SUR1delta2
ABCC8 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 177kDa
NCBI: 000343
UniProt: Q09428
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW