ABCC8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2120437
Article Name: ABCC8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120437
Supplier Catalog Number: orb2120437
Alternative Catalog Number: BYT-ORB2120437-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ABCC8
Conjugation: Biotin
Alternative Names: HI, SUR, HHF1, MRP8, PHHI, SUR1, ABC36, HRINS, PNDM3, TNDM2, SUR1delta2
ABCC8 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 177kDa
NCBI: 000343
UniProt: Q09428
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW