WDSUB1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Artikelnummer: BYT-ORB2120738
Artikelname: WDSUB1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer: BYT-ORB2120738
Hersteller Artikelnummer: orb2120738
Alternativnummer: BYT-ORB2120738-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDSUB1
Konjugation: HRP
Alternative Synonym: UBOX6, WDSAM1
WDSUB1 Rabbit Polyclonal Antibody (HRP)
Klonalität: Polyclonal
Molekulargewicht: 53kDa
NCBI: 689741
UniProt: Q8N9V3
Puffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Formulierung: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequenz: Synthetic peptide located within the following region: KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS