WDSUB1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2120738
Article Name: WDSUB1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120738
Supplier Catalog Number: orb2120738
Alternative Catalog Number: BYT-ORB2120738-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDSUB1
Conjugation: HRP
Alternative Names: UBOX6, WDSAM1
WDSUB1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 689741
UniProt: Q8N9V3
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: KVKSLSSGIPDEFICPITRELMKDPVIASDGYSYEKEAMENWISKKKRTS