TRIM51 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2120815
Artikelname: TRIM51 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2120815
Hersteller Artikelnummer: orb2120815
Alternativnummer: BYT-ORB2120815-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TRIM51
Konjugation: Biotin
Alternative Synonym: SPRYD5, TRIM51A
TRIM51 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 33kDa
UniProt: Q9BSJ1
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: PVNPELSAGPITGLLDSLSGFRVDFTLQPERANSHIFLCGDLRSMNVGCD