TRIM51 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2120815
Article Name: TRIM51 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2120815
Supplier Catalog Number: orb2120815
Alternative Catalog Number: BYT-ORB2120815-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TRIM51
Conjugation: Biotin
Alternative Names: SPRYD5, TRIM51A
TRIM51 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 33kDa
UniProt: Q9BSJ1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PVNPELSAGPITGLLDSLSGFRVDFTLQPERANSHIFLCGDLRSMNVGCD