RBBP6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2121235
Artikelname: RBBP6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2121235
Hersteller Artikelnummer: orb2121235
Alternativnummer: BYT-ORB2121235-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RBBP6
Konjugation: Biotin
Alternative Synonym: PACT, MY038, P2P-R, RBQ-1, SNAMA
RBBP6 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 104kDa
NCBI: 116015
UniProt: Q7Z6E9
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: NYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNA