RBBP6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2121235
Article Name: RBBP6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121235
Supplier Catalog Number: orb2121235
Alternative Catalog Number: BYT-ORB2121235-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RBBP6
Conjugation: Biotin
Alternative Names: PACT, MY038, P2P-R, RBQ-1, SNAMA
RBBP6 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 104kDa
NCBI: 116015
UniProt: Q7Z6E9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNA