Ube2h Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer:
BYT-ORB2121337
| Artikelname: |
Ube2h Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2121337 |
| Hersteller Artikelnummer: |
orb2121337 |
| Alternativnummer: |
BYT-ORB2121337-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ube2h |
| Konjugation: |
Biotin |
| Alternative Synonym: |
Gid, Gid3, Ubc8, E2-20K, N28148, AI181839, AI326965, AI462483, AW227540, 1500009C23Rik |
| Ube2h Rabbit Polyclonal Antibody (Biotin) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
21kDa |
| NCBI: |
033485 |
| UniProt: |
P62257 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequenz: |
Synthetic peptide located within the following region: PSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKV |
