Ube2h Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2121337
| Article Name: |
Ube2h Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2121337 |
| Supplier Catalog Number: |
orb2121337 |
| Alternative Catalog Number: |
BYT-ORB2121337-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ube2h |
| Conjugation: |
Biotin |
| Alternative Names: |
Gid, Gid3, Ubc8, E2-20K, N28148, AI181839, AI326965, AI462483, AW227540, 1500009C23Rik |
| Ube2h Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
21kDa |
| NCBI: |
033485 |
| UniProt: |
P62257 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: PSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKV |
