Parp8 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Artikelnummer:
BYT-ORB2121557
| Artikelname: |
Parp8 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage |
| Artikelnummer: |
BYT-ORB2121557 |
| Hersteller Artikelnummer: |
orb2121557 |
| Alternativnummer: |
BYT-ORB2121557-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human Parp8 |
| Konjugation: |
HRP |
| Alternative Synonym: |
ARTD16, D13Ertd275, D13Ertd275e, 2810430O08Rik |
| Parp8 Rabbit Polyclonal Antibody (HRP) |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
99kDa |
| NCBI: |
001074478 |
| Puffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Formulierung: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequenz: |
Synthetic peptide located within the following region: ITSETTSPSAPASARGIYLMGMCSRQERIQKDIDVVIQKSRAEKDCLFAD |
