Parp8 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2121557
Article Name: Parp8 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2121557
Supplier Catalog Number: orb2121557
Alternative Catalog Number: BYT-ORB2121557-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human Parp8
Conjugation: HRP
Alternative Names: ARTD16, D13Ertd275, D13Ertd275e, 2810430O08Rik
Parp8 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 99kDa
NCBI: 001074478
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: ITSETTSPSAPASARGIYLMGMCSRQERIQKDIDVVIQKSRAEKDCLFAD