NPY1R Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Artikelnummer: BYT-ORB2123136
Artikelname: NPY1R Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Artikelnummer: BYT-ORB2123136
Hersteller Artikelnummer: orb2123136
Alternativnummer: BYT-ORB2123136-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NPY1R
Konjugation: FITC
Alternative Synonym: NPYR, NPY1-R
NPY1R Rabbit Polyclonal Antibody (FITC)
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 000900
UniProt: P25929
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI