NPY1R Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2123136
Article Name: NPY1R Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2123136
Supplier Catalog Number: orb2123136
Alternative Catalog Number: BYT-ORB2123136-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NPY1R
Conjugation: FITC
Alternative Names: NPYR, NPY1-R
NPY1R Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 000900
UniProt: P25929
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI