HSD17B11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2124790
Artikelname: HSD17B11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2124790
Hersteller Artikelnummer: orb2124790
Alternativnummer: BYT-ORB2124790-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B11
Konjugation: Biotin
Alternative Synonym: DHRS8, PAN1B, RETSDR2, SDR16C2, 17BHSD11, 17-BETA-HSD11, 17-BETA-HSDXI
HSD17B11 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 33kDa
NCBI: 057329
UniProt: Q8NBQ5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG