HSD17B11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2124790
Article Name: HSD17B11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2124790
Supplier Catalog Number: orb2124790
Alternative Catalog Number: BYT-ORB2124790-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HSD17B11
Conjugation: Biotin
Alternative Names: DHRS8, PAN1B, RETSDR2, SDR16C2, 17BHSD11, 17-BETA-HSD11, 17-BETA-HSDXI
HSD17B11 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 057329
UniProt: Q8NBQ5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG