RNASEN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2124979
Artikelname: RNASEN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2124979
Hersteller Artikelnummer: orb2124979
Alternativnummer: BYT-ORB2124979-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNASEN
Konjugation: Biotin
Alternative Synonym: RN3, ETOHI2, RNASEN, RANSE3L, RNASE3L, HSA242976
RNASEN Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 159kDa
NCBI: 037367
UniProt: Q9NRR4
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK