RNASEN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2124979
Article Name: RNASEN Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2124979
Supplier Catalog Number: orb2124979
Alternative Catalog Number: BYT-ORB2124979-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RNASEN
Conjugation: Biotin
Alternative Names: RN3, ETOHI2, RNASEN, RANSE3L, RNASE3L, HSA242976
RNASEN Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 159kDa
NCBI: 037367
UniProt: Q9NRR4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK