HNRPA0 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2125063
Artikelname: HNRPA0 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2125063
Hersteller Artikelnummer: orb2125063
Alternativnummer: BYT-ORB2125063-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, IP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HNRPA0
Konjugation: Biotin
Alternative Synonym: HNRPA0
HNRPA0 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 006796
UniProt: Q13151
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG