HNRPA0 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125063
Article Name: HNRPA0 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125063
Supplier Catalog Number: orb2125063
Alternative Catalog Number: BYT-ORB2125063-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IF, IHC, IP, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HNRPA0
Conjugation: Biotin
Alternative Names: HNRPA0
HNRPA0 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 006796
UniProt: Q13151
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG