SRSF10 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2125087
Artikelname: SRSF10 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2125087
Hersteller Artikelnummer: orb2125087
Alternativnummer: BYT-ORB2125087-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FUSIP1
Konjugation: Biotin
Alternative Synonym: NSSR, TASR, SRp38, TASR1, TASR2, FUSIP1, FUSIP2, SFRS13, SRrp40, SFRS13A, PPP1R149
SRSF10 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 473357
UniProt: O75494
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRP