SRSF10 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125087
Article Name: SRSF10 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125087
Supplier Catalog Number: orb2125087
Alternative Catalog Number: BYT-ORB2125087-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FUSIP1
Conjugation: Biotin
Alternative Names: NSSR, TASR, SRp38, TASR1, TASR2, FUSIP1, FUSIP2, SFRS13, SRrp40, SFRS13A, PPP1R149
SRSF10 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 473357
UniProt: O75494
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRP