SF3A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2125222
Artikelname: SF3A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2125222
Hersteller Artikelnummer: orb2125222
Alternativnummer: BYT-ORB2125222-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SF3A1
Konjugation: Biotin
Alternative Synonym: PRP21, PRPF21, SAP114, SF3A120
SF3A1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 89kDa
NCBI: 005868
UniProt: Q15459
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT