SF3A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2125222
| Article Name: |
SF3A1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2125222 |
| Supplier Catalog Number: |
orb2125222 |
| Alternative Catalog Number: |
BYT-ORB2125222-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IF, IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human SF3A1 |
| Conjugation: |
Biotin |
| Alternative Names: |
PRP21, PRPF21, SAP114, SF3A120 |
| SF3A1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
89kDa |
| NCBI: |
005868 |
| UniProt: |
Q15459 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT |
