GIPC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2125255
Artikelname: GIPC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2125255
Hersteller Artikelnummer: orb2125255
Alternativnummer: BYT-ORB2125255-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GIPC1
Konjugation: Biotin
Alternative Synonym: NIP, GIPC, IIP-1, OPDM2, TIP-2, SEMCAP, C19orf3, Hs.6454, GLUT1CBP, RGS19IP1, SYNECTIN, SYNECTIIN
GIPC1 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 37kDa
NCBI: 974199
UniProt: O14908
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA