GIPC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125255
Article Name: GIPC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125255
Supplier Catalog Number: orb2125255
Alternative Catalog Number: BYT-ORB2125255-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GIPC1
Conjugation: Biotin
Alternative Names: NIP, GIPC, IIP-1, OPDM2, TIP-2, SEMCAP, C19orf3, Hs.6454, GLUT1CBP, RGS19IP1, SYNECTIN, SYNECTIIN
GIPC1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 974199
UniProt: O14908
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA