PRPF4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2125378
Artikelname: PRPF4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2125378
Hersteller Artikelnummer: orb2125378
Alternativnummer: BYT-ORB2125378-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRPF4
Konjugation: Biotin
Alternative Synonym: PRP4, RP70, HPRP4, Prp4p, HPRP4P, SNRNP60
PRPF4 Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 004688
UniProt: O43172
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT