PRPF4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125378
Article Name: PRPF4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125378
Supplier Catalog Number: orb2125378
Alternative Catalog Number: BYT-ORB2125378-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRPF4
Conjugation: Biotin
Alternative Names: PRP4, RP70, HPRP4, Prp4p, HPRP4P, SNRNP60
PRPF4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 004688
UniProt: O43172
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT