HNRNPU Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Artikelnummer: BYT-ORB2125432
Artikelname: HNRNPU Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Artikelnummer: BYT-ORB2125432
Hersteller Artikelnummer: orb2125432
Alternativnummer: BYT-ORB2125432-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HNRNPU
Konjugation: Biotin
Alternative Synonym: SAFA, DEE54, HNRPU, SAF-A, U21.1, pp120, EIEE54, GRIP120, hnRNP U, HNRNPU-AS1
HNRNPU Rabbit Polyclonal Antibody (Biotin)
Klonalität: Polyclonal
Molekulargewicht: 90kDa
NCBI: 114032
UniProt: Q00839
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequenz: Synthetic peptide located within the following region: EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF