HNRNPU Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2125432
Article Name: HNRNPU Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2125432
Supplier Catalog Number: orb2125432
Alternative Catalog Number: BYT-ORB2125432-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HNRNPU
Conjugation: Biotin
Alternative Names: SAFA, DEE54, HNRPU, SAF-A, U21.1, pp120, EIEE54, GRIP120, hnRNP U, HNRNPU-AS1
HNRNPU Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 90kDa
NCBI: 114032
UniProt: Q00839
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF